.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p4p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a CorC_HlyC domain from Haemophilus ducreyi. To be Published
    Site MCSG
    PDB Id 2p4p Target Id APC86433.2
    Molecular Characteristics
    Source Haemophilus ducreyi 35000hp
    Alias Ids TPS5850,AAP96548.1, PF03471, 233412 Molecular Weight 10073.13 Da.
    Residues 83 Isoelectric Point 5.32
    Sequence mrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydkykfeiidten fridqlmvsfrkdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.26189
    Matthews' coefficent 1.75 Rfactor 0.20793
    Waters 98 Solvent Content 29.85

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CA (CALCIUM) x 1;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2p4p
    1. Prediction of ligand binding sites using homologous structures and conservation at CASP8
    MN Wass, MJE Sternberg - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     
    2. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch