.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the domain of putative sensory box/GGDEF family protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2p7j Target Id APC90919.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6001,NP_796733.1, 223926 Molecular Weight 33013.42 Da.
    Residues 286 Isoelectric Point 5.47
    Sequence qkyqallannventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenmws svarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldneqisawgieler dkgelvyplspslrilmpisvndvrqgylvlnvdieylssllnyspvrdfhielvkhkgfyiaspdesr lygdiipersqfnfsnmypdiwprvvseqagysysgehliafssikfvsneplhliidlsneqlskrat rdindliqes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.23863
    Matthews' coefficent 2.73 Rfactor 0.19346
    Waters 321 Solvent Content 54.97

    Ligand Information
    Ligands SO4 (SULFATE) x 2;ACY (ACETIC) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2p7j
    1. Crystal structures of YkuI and its complex with second messenger cyclic Di-GMP suggest catalytic mechanism of phosphodiester bond cleavage by EAL domains
    G Minasov, S Padavattan, L Shuvalova - Journal of Biological , 2009 - ASBMB
     
    2. Structural characterization of the predominant family of histidine kinase sensor domains
    Z Zhang, WA Hendrickson - Journal of molecular biology, 2010 - Elsevier
     
    3. Extracytoplasmic PAS-like domains are common in signal transduction proteins
    C Chang, C Tesar, M Gu, G Babnigg - Journal of , 2010 - Am Soc Microbiol
     
    4. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch