.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p90

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032. To be Published
    Site MCSG
    PDB Id 2p90 Target Id APC86077
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS5818,CAF20264.1, PF01908, 196627 Molecular Weight 35247.34 Da.
    Residues 319 Isoelectric Point 4.67
    Sequence msdnndrmyeleypspevsgqtaggptlivalqgyadaghavesssshlmdaldhrliasfnndelidy rsrrpvvviehnevtsmdelnlglhvvrdndnkpflmlsgpepdlrwgdfsnavvdlvekfgventicl yaapmtvphtrptvvtahgnstdrlkdqvsldtrmtvpgsaslmlekllkdkgknvsgytvhvphyvsa spypaatlkllqsiadsadlnlpllalerdaekvhrqlmeqteesseiqrvvgaleqqydseleryrnr hpqavmpgeselpsgdeigaefekfladlddqggsdhketpea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.35 Rfree 0.25119
    Matthews' coefficent 2.66 Rfactor 0.19322
    Waters 326 Solvent Content 53.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p90
    1. Unraveling the biochemistry and provenance of pupylation: a prokaryotic analog of ubiquitination
    LM Iyer, AM Burroughs, L Aravind - Biology direct, 2008 - biomedcentral.com
     
    2. Structure of Mycobacterium tuberculosis Rv2714, a representative of a duplicated gene family in Actinobacteria
    M Graa, M Bellinzoni, I Miras - Section F: Structural , 2009 - scripts.iucr.org
     
    3. Beta-Strand Interfaces of Non-Dimeric Protein Oligomers Are Characterized by Scattered Charged Residue Patterns
    G Feverati, M Achoch, J Zrimi, L Vuillon, C Lesieur - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch