.
The Open Protein Structure Annotation Network
PDB Keyword
.

2paq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insight into the mechanism of substrate specificity and catalytic activity of an HD-domain phosphohydrolase: the 5'-deoxyribonucleotidase YfbR from Escherichia coli. J.Mol.Biol. 378 215-226 2008
    Site MCSG
    PDB Id 2paq Target Id APC11001
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS5185,AAC75351, 562 Molecular Weight 22706.82 Da.
    Residues 199 Isoelectric Point 5.52
    Sequence mkqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeriallamyhd asevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplidehaysdeekslvkqada lcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfhlsldeisqdspl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.237
    Matthews' coefficent 2.24 Rfactor 0.187
    Waters 126 Solvent Content 45.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2paq
    1. Structural insight into the mechanism of substrate specificity and catalytic activity of an HD-domain phosphohydrolase: the 5'-deoxyribonucleotidase YfbR from
    MD Zimmerman, M Proudfoot, A Yakunin - Journal of molecular , 2008 - Elsevier
     
    2. A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses
    D Sun, G Lee, JH Lee, HY Kim, HW Rhee - Nature structural & , 2010 - nature.com
     
    3. Structure and activity of the Cas3 HD nuclease MJ0384, an effector enzyme of the CRISPR interference
    N Beloglazova, P Petit, R Flick, G Brown - The EMBO , 2011 - nature.com
     
    4. The Structure of an Unconventional HD-GYP Protein from Bdellovibrio Reveals the Roles of Conserved Residues in this Class of Cyclic-di-GMP Phosphodiesterases
    AL Lovering, MJ Capeness, C Lambert, L Hobley - mBio, 2011 - Am Soc Microbiol
     
    5. VV prasanth & S. Chitti: Predicting the function of a hypothetical protein from Pyrococcus horikoshii OT3 as HD domain containing metal-dependent
    PA Babu, K Harshita - The Internet Journal of Genomics and Proteomics, 2010 - ispub.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch