.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pdo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Acetyltransferase of GNAT Family from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 2pdo Target Id APC27842
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5392,AAP17807, 198215 Molecular Weight 16324.78 Da.
    Residues 141 Isoelectric Point 4.85
    Sequence meirvfrqedfeevitlwercdllrpwndpemdierkmnhdvslflvaevngevvgtvmggydghrgsa yylgvhpefrgrgianallnrlekkliargcpkiqinvpedndmvlgmyerlgyehadvlslgkrlied eey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.266
    Matthews' coefficent 2.16 Rfactor 0.193
    Waters 587 Solvent Content 42.96

    Ligand Information
    Ligands ACY (ACETIC) x 2;EDO (1,2-ETHANEDIOL) x 7
    Metals ZN (ZINC) x 5

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch