The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the C-terminal domain of histidine utilization repressor from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 2pkh Target Id APC84836
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5749,AAO58598.1, PF07702, 223283 Molecular Weight 16450.94 Da.
    Residues 145 Isoelectric Point 6.73
    Sequence arghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdylkqdft lqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqpvtaarlihpgsrhr legrftk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.95 Rfree 0.27728
    Matthews' coefficent 2.46 Rfactor 0.21945
    Waters 931 Solvent Content 49.96

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 32



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch