.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pls

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the CorC/HlyC transporter associated domain of a CBS domain protein from Chlorobium tepidum TLS. To be Published
    Site MCSG
    PDB Id 2pls Target Id APC86064.2
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS5815,AAM71783.1, PF03471, 194439 Molecular Weight 9522.51 Da.
    Residues 83 Isoelectric Point 4.75
    Sequence vqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfwenwrlevidm dskridkvlatkid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.15 Rfree 0.23203
    Matthews' coefficent 2.62 Rfactor 0.17582
    Waters 559 Solvent Content 52.97

    Ligand Information
    Ligands ACT (ACETATE) x 4;EDO (1,2-ETHANEDIOL) x 13;FMT (FORMIC) x 6
    Metals MG (MAGNESIUM) x 6

    Jmol

     
    Google Scholar output for 2pls
    1. Prediction of ligand binding sites using homologous structures and conservation at CASP8
    MN Wass, MJE Sternberg - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch