.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ppw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of uncharacterized Ribose 5-phosphate isomerase RpiB from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2ppw Target Id APC80227
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5591,AAK74495, BIG_563.1, 170187 Molecular Weight 23676.83 Da.
    Residues 213 Isoelectric Point 4.94
    Sequence mkialinensqasknhiiydslkeatdkkgyqlfnygmrgeegesqltyvqnglmaaillntkavdfvv tgcgtgvgamlalnsfpgvvcglavdptdaylysqinggnalsipyakgfgwgaeltlklmferlfaee mgggyprervipeqrnarilnevkqithndlmtilkiidqdflkdtisgkyfqeyffencqddevaayl kevlak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.21807
    Matthews' coefficent 2.13 Rfactor 0.17691
    Waters 271 Solvent Content 42.24

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ppw
    1. D-ribose-5-phosphate isomerase B from Escherichia coli is also a functional D-allose-6-phosphate isomerase, while the Mycobacterium tuberculosis enzyme is not
    AK Roos, S Mariano, E Kowalinski, L Salmon - Journal of molecular , 2008 - Elsevier
     
    2. Structures of type B ribose 5_phosphate isomerase from Trypanosoma cruzi shed light on the determinants of sugar specificity in the structural family
    AL Stern, A Naworyta, JJ Cazzulo, SL Mowbray - FEBS Journal, 2011 - Wiley Online Library
     
    3. Structural characterization of a ribose-5-phosphate isomerase B from the pathogenic fungus Coccidioides immitis
    TE Edwards, AB Abramov, ER Smith - BMC structural , 2011 - biomedcentral.com
     
    4. For Review Only
    A Naworyta, T de Chascoms, S Mowbray - FEBS Journal, 2011 - uu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch