.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pqq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 2pqq Target Id APC7345
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5119,NP_627768.1, 100226 Molecular Weight 15834.06 Da.
    Residues 145 Isoelectric Point 5.06
    Sequence mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrtspdgrenml avvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpevatallravarrlrktndam sdlvfsd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.28069
    Matthews' coefficent 2.21 Rfactor 0.22918
    Waters 251 Solvent Content 44.37

    Ligand Information
    Ligands FMT (FORMIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 2pqq
    1. Sequence or structure: using bioinformatics and homology modeling to understand functional relationships in cAMP/cGMP binding domains
    NA LaFranzo, MK Strulson, DM Yanker, LT Dang - Mol. BioSyst., 2010 - xlink.rsc.org
     
    2. Crystallization and preliminary X-ray crystallographic characterization of a cyclic nucleotide-binding homology domain from the mouse EAG potassium channel
    MJ Marques-Carvalho - Crystallographica Section F , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch