.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tyr/ser protein phosphatase from Vaccinia virus WR. To be Published
    Site MCSG
    PDB Id 2q05 Target Id APC7320
    Molecular Characteristics
    Source Vaccinia virus wr
    Alias Ids TPS5115,AAO89378.1, 10254 Molecular Weight 19724.84 Da.
    Residues 171 Isoelectric Point 9.21
    Sequence mdkkslykylllrstgdmhraksptimtrvtnnvylgnyknamdapssevkfkyvlnltmdkytlpnsn iniihiplvddtttdiskyfddvtaflskcdqrnepvlvhcaagvnrsgamilaylmsknkeslpmlyf lyvyhsmrdlrgafvenpsfkrqiiekyvidkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.57 Rfree 0.2183
    Matthews' coefficent 4.40 Rfactor 0.1913
    Waters 63 Solvent Content 72.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q05
    1. Crystallization and preliminary X-ray diffraction analysis of vaccinia virus H1L phosphatase
    L Roces, PP Knowles, G Fox, J Juanhuix - Section F: Structural , 2008 - scripts.iucr.org
     
    2. Bioinformatics at the interface of 21st century Chemistry and Biology
    MK AZIM - Journal of the Chemical Society of Pakistan, 2011 - jcsp.org.pk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch