.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qh9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a protein of unknown function from Archaeoglobus fulgidus DSM 4304. To be Published
    Site MCSG
    PDB Id 2qh9 Target Id APC86486.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5851,AAB89811.1, BIG_103.1, 224325 Molecular Weight 20209.49 Da.
    Residues 178 Isoelectric Point 7.62
    Sequence mkkwrflgiddsfddrkccvvgcvtcggyvegflyteididgldatdklismvrrskfreqikciflpg itlggfnlvdiqrvyretkipvvvvmrrkpdmeefdsamrnlenyelrrkivevageihrigdiyiqta gltpseaeklvkaslikgnmpepvrishlvasaiihgesr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.25471
    Matthews' coefficent 2.15 Rfactor 0.22384
    Waters 144 Solvent Content 42.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qh9
    1. Modeling of Escherichia coli Endonuclease V structure in complex with DNA
    KA Majorek, JM Bujnicki - Journal of molecular modeling, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch