.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qhk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the methyl-accepting chemotaxis protein from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 2qhk Target Id APC91175.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6015,NP_796562.1, 223926 Molecular Weight 19611.16 Da.
    Residues 173 Isoelectric Point 5.42
    Sequence nssksleaelvrdrqelidarkkelkaymmmgvtaikplydsdvngsnkqaakeilkamrfesdgyffa ydsqgintlhaikpslegknlydlkdengvaviaglidasqkgdgflyfswhkptinaqapklgyaeyl qkwdwvlgtgiyiddidqqvamqrelrtqelnqht
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.91 Rfree 0.21274
    Matthews' coefficent 2.47 Rfactor 0.17174
    Waters 251 Solvent Content 50.25

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qhk
    1. Structure and signaling mechanism of Per-ARNT-Sim domains
    A Mglich, RA Ayers, K Moffat - Structure, 2009 - Elsevier
     
    2. Sensor domains of two-component regulatory systems
    J Cheung, WA Hendrickson - Current opinion in microbiology, 2010 - Elsevier
     
    3. Sensing of environmental signals: classification of chemoreceptors according to the size of their ligand binding regions
    J Lacal, C Garca_Fontana - Environmental , 2010 - Wiley Online Library
     
    4. Extracytoplasmic PAS-like domains are common in signal transduction proteins
    C Chang, C Tesar, M Gu, G Babnigg - Journal of , 2010 - Am Soc Microbiol
     
    5. The crystal structure of the periplasmic domain of Vibrio parahaemolyticus CpxA
    E Kwon, DY Kim, TD Ngo, CA Gross, JD Gross - Protein , 2012 - Wiley Online Library
     
    6. Structure and Proposed Mechanism for the pH-Sensing Helicobacter pylori Chemoreceptor TlpB
    E Goers Sweeney, JN Henderson, J Goers, C Wreden - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch