.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qhq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein VPA0580. To be Published
    Site MCSG
    PDB Id 2qhq Target Id APC86649
    Related PDB Ids 2qm2 
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5863,NP_800090.1, BIG_86.1, 223926 Molecular Weight 13668.55 Da.
    Residues 122 Isoelectric Point 4.40
    Sequence malgfgmkmelqqfldalasspekiefettmaviednydftpaaftngntqndanenngsckifafgll naldkeatlacfgrfyredvllhpenndhqnirnfmvtgwegiqfetsaltak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.20926
    Matthews' coefficent 2.15 Rfactor 0.17009
    Waters 276 Solvent Content 42.92

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qhq
    1. Large-scale evaluation of protein reductive methylation for improving protein crystallization
    Y Kim, P Quartey, H Li, L Volkart, C Hatzos, C Chang - Nature , 2008 - nature.com
     
    2. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch