.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qlt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an isoform of DL-glycerol-3-phosphatase, Rhr2p from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 2qlt Target Id APC7326
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS5116,NP_012211.1, 4932 Molecular Weight 30437.28 Da.
    Residues 271 Isoelectric Point 6.11
    Sequence mkrfnvlkyirttkaniqtiamplttkplslkinaalfdvdgtiiisqpaiaafwrdfgkdkpyfdaeh vihishgwrtydaiakfapdfadeeyvnklegeipekygehsievpgavklcnalnalpkekwavatsg trdmakkwfdilkikrpeyfitandvkqgkphpepylkgrnglgfpineqdpskskvvvfedapagiaa gkaagckivgiattfdldflkekgcdiivknhesirvgeynaetdevelifddylyakddllkw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.19513
    Matthews' coefficent Rfactor 0.16754
    Waters 248 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EDO (1,2-ETHANEDIOL) x 2
    Metals HG (MERCURY) x 4;CA (CALCIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch