.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qm1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glucokinase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2qm1 Target Id APC29523
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5458,AAO82484, 226185 Molecular Weight 34230.02 Da.
    Residues 323 Isoelectric Point 5.02
    Sequence mdkkiigidlggttikfailttdgvvqqkwsietniledgkhivpsiiesirhridlynmkkedfvgig mgtpgsvdiekgtvvgaynlnwttvqpvkeqiesalgipfaldndanvaalgerwkgagennpdvifit lgtgvgggivaagkllhgvagcagevghvtvdpngfdctcgkrgcletvssatgvvrvarhlseefagd selkqaiddgqdvsskdvfefaekgdhfalmvvdrvcfylglatgnlgntlnpdsvvigggvsaagefl rsrvekyfqeftfpqvrnstkiklaelgneagvigaaslalqfskek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.02 Rfree 0.230
    Matthews' coefficent 2.42 Rfactor 0.186
    Waters 915 Solvent Content 49.27

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 6;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals MG (MAGNESIUM) x 5;ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2qm1
    1. Structural Studies of ROK Fructokinase YdhR from Bacillus subtilis: Insights into Substrate Binding and Fructose Specificity
    B Nocek, AJ Stein, R Jedrzejczak, ME Cuff, H Li - Journal of Molecular , 2011 - Elsevier
     
    2. Substrate recognition mechanism and substrate-dependent conformational changes of an ROK family glucokinase from Streptomyces griseus
    K Miyazono, N Tabei, S Morita, Y Ohnishi - Journal of , 2012 - Am Soc Microbiol
     
    3. Insights from Streptococcus pneumoniae glucose kinase structural model
    C Mulakayala, BN Banaganapalli, CM Anuradha - , 2009 - ncbi.nlm.nih.gov
     
    4. Characterization and crystal structure of the thermophilic ROK hexokinase from Thermus thermophilus
    T Nakamura, Y Kashima, S Mine, T Oku - Journal of Bioscience and , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch