.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qm2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative HopJ type III Effector Protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2qm2 Target Id APC86649
    Related PDB Ids 2qhq 
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5864,NP_800090.1, BIG_86.1, 223926 Molecular Weight 13668.55 Da.
    Residues 122 Isoelectric Point 4.40
    Sequence malgfgmkmelqqfldalasspekiefettmaviednydftpaaftngntqndanenngsckifafgll naldkeatlacfgrfyredvllhpenndhqnirnfmvtgwegiqfetsaltak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.281
    Matthews' coefficent 2.54 Rfactor 0.209
    Waters 200 Solvent Content 51.60

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;GOL (GLYCEROL) x 1
    Metals K (POTASSIUM) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2qm2
    1. Large-scale evaluation of protein reductive methylation for improving protein crystallization
    Y Kim, P Quartey, H Li, L Volkart, C Hatzos, C Chang - Nature , 2008 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2qhq.png
    No description
    25.01 kB22:14, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch