.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qm3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a predicted methyltransferase from Pyrococcus furiosus. TO BE PUBLISHED
    Site MCSG
    PDB Id 2qm3 Target Id APC85638
    Molecular Characteristics
    Source Pyrococcus furiosus dsm 3638
    Alias Ids TPS5780,AAL81235.1, PF01861, 186497 Molecular Weight 40324.70 Da.
    Residues 349 Isoelectric Point 4.68
    Sequence mkeivervktktkipvyersvenvlsavlasddiwrivdlseeplplvvaileslnelgyvtfedgvkl tekgeelvaeygigkrydftcphcqgktvdlqafadlleqfreivkdrpeplhefdqayvtpettvarv ilmhtrgdlenkdifvlgdddltsialmlsglpkriavldiderltkfiekaaneigyedieiftfdlr kplpdyalhkfdtfitdppetleairafvgrgiatlkgprcagyfgitrressldkwreiqklllnefn vvitdiirnfneyvnwgyaeetrawklipikklpeynwyksymfrietlegsrgyedeipeediyndeesstt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.22657
    Matthews' coefficent 2.18 Rfactor 0.18296
    Waters 223 Solvent Content 43.71

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch