.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of glutamate decarboxylase domain of diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2qma Target Id APC91511.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6032,NP_798321.1, 223926 Molecular Weight 53866.45 Da.
    Residues 494 Isoelectric Point 5.19
    Sequence iaaggshveaapqeewkkhfihtgelgsaefasvmshttsamksvfeqvnapysgmdpkaledainavd ldnknaplksviddvaelvaknaiftqhpdciahlhtpplmpavaaeamiaalnqsmdswdqassatyv eqkvvnwlcdkydlsekadgiftsggtqsnqmglmlardwiadklsghsiqklglpdyadklrivcskk shftvqksaswmglgekavmtvdanadgtmditkldeviaqakaeglipfaivgtagttdhgaiddldf iadmavkhdmwmhvdgayggalilsshksrlkgverahsisvdfhklfyqtiscgallvndksnfkfll hhadylnrehdelpnlvdksiattkrfdalkvfmtmqnvgpkalgdmydhllaqtlevadmirtndqfe llaepslstvlfrathetadldelnkalrlealtrgiavlgetivdgktalkftilnpclttsdfesll skinmlavelv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.81 Rfree 0.2090
    Matthews' coefficent 2.30 Rfactor 0.1813
    Waters 673 Solvent Content 46.43

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qma
    1. Evolution of a novel lysine decarboxylase in siderophore biosynthesis
    M Burrell, CC Hanfrey, LN Kinch, KA Elliott - Molecular , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch