.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qmm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APC86534.1 (C-terminal domain of NCBI AAB90184.1; Pfam BIG 123.1). To be Published
    Site MCSG
    PDB Id 2qmm Target Id APC86534.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5856,AAB90184.1, BIG_123.1, 224325 Molecular Weight 21605.87 Da.
    Residues 194 Isoelectric Point 6.72
    Sequence vrgflivgnkaftqpfslndlpgagrmdvlcrctsqalfishgirrdvevyllllgppsppksilikgd evrrmspdernvaghikkalavecgkswkkvhsgvyvsrkgleelieelsekysiiylkedgvdisnaq lppnplfvigdheglteeqekvveryaalklslsplsllaeqcvviahhhldrlqf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.24341
    Matthews' coefficent 3.36 Rfactor 0.22562
    Waters 112 Solvent Content 63.37

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qmm
    1. 3D-Fun: predicting enzyme function from structure
    M Von Grotthuss, D Plewczynski, G Vriend - Nucleic Acids , 2008 - Oxford Univ Press
     
    2. Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
    HY Chen, YA Yuan - Journal of Molecular Cell Biology, 2010 - jmcb.oxfordjournals.org
     
    3. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch