.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qmx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine. J.Struct.Biol. 162 94-107 2008
    Site MCSG
    PDB Id 2qmx Target Id APC86053
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS5812,AAM72891.1, PF00800, 194439 Molecular Weight 31097.64 Da.
    Residues 280 Isoelectric Point 5.74
    Sequence mtnwliayqgepgayseiaalrfgeplpcesfddvfsavteqkadyavipienslggsihqnydlllrr pvvilaetfvkvehcllglpgasvetatkamshpqalvqchnffathpqiraeaaydtagsakmvaesr dksalaiaskragelygldilkenladeewnitrffciahennpdishlkvrpdvarqktsivfalpne qgslfralatfalrgidltkiesrpsrkkafeylfyadfighredqnvhnalenlrefatmvkvlgsyg vvnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.28899
    Matthews' coefficent 2.49 Rfactor 0.21916
    Waters 38 Solvent Content 50.55

    Ligand Information
    Ligands PHE (1,2-ETHANEDIOL) x 2;EDO (ACETATE) x 11;ACT x 2
    Metals

    Jmol

     
    Google Scholar output for 2qmx
    1. Structures of open (R) and close (T) states of prephenate dehydratase (PDT)--Implication of allosteric regulation by l-phenylalanine
    K Tan, H Li, R Zhang, M Gu, ST Clancy - Journal of structural , 2008 - Elsevier
     
    2. Superstoichiometric binding of L-Phe to phenylalanine hydroxylase from Caenorhabditis elegans: evolutionary implications
    MI Flydal, TC Mohn, AL Pey, J Siltberg-Liberles - Amino acids, 2010 - Springer
     
    3. Case Studies: Function Predictions of Structural Genomics Results
    JD Watson, JM Thornton - From Protein Structure to Function with , 2009 - Springer
     
    4. INSILICO EXPRESSION AND IDENTIFICATION OF DRUG TARGET IN Aeromonas hydrophila
    A GANESH - 2008 - digitallibrary.srmuniv.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch