.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qni

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein Atu0299. To be Published
    Site MCSG
    PDB Id 2qni Target Id APC5852
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4872,NP_531005.1, 176299 Molecular Weight 21692.29 Da.
    Residues 198 Isoelectric Point 5.76
    Sequence mhalyithpqvkidpavpvpewglsergaerareasrlpwakalrrivssaetkaietahmlaetsgaa ieiieamhendrsatgflpppefekaadwffahpeesfqgweraidaqariveavkavldrhdarqpia fvghggvgtllkchiegrgisrskdqpagggnlfrfsiaefslaaasptcdwtametwqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.22067
    Matthews' coefficent 3.33 Rfactor 0.19931
    Waters 177 Solvent Content 63.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch