.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qnu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Pa0076 from Pseudomonas aeruginosa PAO1 at 2.05 A resolution. To be Published
    Site MCSG
    PDB Id 2qnu Target Id APC22042
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5206,AAG03466, 208964 Molecular Weight 23872.83 Da.
    Residues 226 Isoelectric Point 4.67
    Sequence mnsvgfygklagrgdfvsrglpntfvepwdawlasgmrasqdelgaawldayltsplwrfaiapgllgg eavtgvvmpsidrvgryfpltvacllpanadlgglvggddgwfeqveslllstlepeaeveafeqavaq lpappcgprieqslisgnllrseavtpaqrlaalaqhacdgashwwgrgsarisaglmryqglppapaf grfltgegeviplfpgipg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.234
    Matthews' coefficent 1.99 Rfactor 0.183
    Waters 120 Solvent Content 38.13

    Ligand Information
    Ligands ACT (ACETATE) x 3;PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qnu
    1. TagR promotes PpkA_catalysed type VI secretion activation in Pseudomonas aeruginosa
    FS Hsu, S Schwarz, JD Mougous - Molecular microbiology, 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch