.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Glyoxalase Family Protein from Bacillus anthracis. To be Published
    Site MCSG
    PDB Id 2qqz Target Id APC89129
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS5943,NP_845964.1, 198094 Molecular Weight 14224.48 Da.
    Residues 123 Isoelectric Point 5.39
    Sequence mrnyiqgidhvqvaapvgceeearafygetigmeeipkpeelkkrggcwfkcgnqeihigveqnfnpak rahpafyvlkidefkqelikqgieviddharpdvirfyvsdpfgnriefmenkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.92 Rfree 0.236
    Matthews' coefficent 2.57 Rfactor 0.196
    Waters 148 Solvent Content 52.12

    Ligand Information
    Ligands SO4 (SULFATE) x 5;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qqz
    1. Bacterial protein structures reveal phylum dependent divergence
    MD Shortridge, T Triplet, P Revesz, MA Griep - biology and chemistry, 2011 - Elsevier
     
    2. COFACTOR: an accurate comparative algorithm for structure-based protein function annotation
    A Roy, J Yang, Y Zhang - Nucleic Acids Research, 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch