.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qrr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Soluble Domain of the ABC Transporter, ATP-binding Protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2qrr Target Id APC91258.2
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6019,NP_797085.1, BIG_1104.2, 223926 Molecular Weight 10945.81 Da.
    Residues 98 Isoelectric Point 4.46
    Sequence lsipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldyaggvkfgmmvae lfgneqddsaaieylrehnvkvevlgyvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.71 Rfree 0.240
    Matthews' coefficent 2.54 Rfactor 0.199
    Waters 128 Solvent Content 51.49

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2qrr
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Building an understanding of cystic fibrosis on the foundation of ABC transporter structures
    JL Mendoza, PJ Thomas - Journal of bioenergetics and biomembranes, 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch