.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qru

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an alpha/beta hydrolase superfamily protein from Enterococcus faecalis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2qru Target Id APC28784
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5418,AAO80242, 226185 Molecular Weight 31109.77 Da.
    Residues 272 Isoelectric Point 5.41
    Sequence mhlknnqtlangatvtiypttteptnyvvylhgggmiygtksdlpeelkelftsngytvlaldyllapn tkidhilrtltetfqllneeiiqnqsfglcgrsaggylmlqltkqlqtlnltpqflvnfygytdlefik eprkllkqaisakeiaaidqtkpvwddpflsryllyhysiqqallphfyglpengdwsayalsdetlkt fppcfstasssdeevpfryskkigrtipestfkavyylehdflkqtkdpsvitlfeqldswlker
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.199
    Matthews' coefficent 2.42 Rfactor 0.167
    Waters 359 Solvent Content 49.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2qru
    1. Computational study of the heterodimerization between _ and _ receptors
    X Liu, M Kai, L Jin, R Wang - Journal of computer-aided molecular design, 2009 - Springer
     
    2. The crystal structure of an esterase from the hyperthermophilic microorganism Pyrobaculum calidifontis VA1 explains its enantioselectivity
    GJ Palm, E Fernndez-lvaro, X Bogdanovi_ - Applied microbiology , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch