.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of J-domain of DnaJ homolog dnj-2 precursor from C.elegans. To be Published
    Site MCSG
    PDB Id 2qsa Target Id APC90001.8
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS5957,Q17433, 6239 Molecular Weight 12820.75 Da.
    Residues 106 Isoelectric Point 6.35
    Sequence vgfapelycglencydvlevnreefdkqklakayralarkhhpdrvknkeekllaeerfrviatayetl kddeaktnydyyldhpdqrfynyyqyyrlraapkvdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.68 Rfree 0.1803
    Matthews' coefficent 2.90 Rfactor 0.1631
    Waters 111 Solvent Content 57.58

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2qsa
    1. The Crystal Structure of the Human Co-Chaperone P58IPK
    M Svrd, EI Biterova, JM Bourhis, JE Guy - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch