.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum. TO BE PUBLISHED
    Site MCSG
    PDB Id 2qsb Target Id APC86530.1
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5855,CAC11739.1, BIG_119.2, 2303 Molecular Weight 9693.53 Da.
    Residues 86 Isoelectric Point 4.64
    Sequence mvrvdqnlfnevmylldelsqditvpknvrkvaqdskaklsqenesldlrcatvlsmldemandpnvpa hgrtdlytiiskleals
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.178
    Matthews' coefficent 2.15 Rfactor 0.147
    Waters 128 Solvent Content 42.90

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch