.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein of unknown function from Porphyromonas gingivalis W83. TO BE PUBLISHED
    Site MCSG
    PDB Id 2qsv Target Id APC90093.2
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5968,AAQ65534.1, 242619 Molecular Weight 23721.99 Da.
    Residues 220 Isoelectric Point 4.94
    Sequence gplqvsnarllfpismpedegvvrlvvnntdesdlqvavvslpsfvslddrafrlqareprelnlslav prnmppgmkdeplvlevtspetgkkavdsvmvslplvdnfpaltaaqtgvmelstyldmgqldgettka aieirnvgagplrlhsvttrnpaltavpdrteikpggstllriavdpqvmkaegwqsiaadisiicndp qaplrrikvkael
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.23285
    Matthews' coefficent 4.18 Rfactor 0.20382
    Waters 198 Solvent Content 70.59

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2qsv
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch