.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of C-terminal domain of ABC transporter / ATP-binding protein from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2qsw Target Id APC87322.1
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5880,AAO82214.1, BIG_1104.5, 226185 Molecular Weight 10952.04 Da.
    Residues 97 Isoelectric Point 4.80
    Sequence knieetelvveemleqypngkivrllfhgeqaklpiishivqeyqvevsiiqgniqqtkqgavgslyiq llgeeqnilaaieglrklrvetevigne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.1842
    Matthews' coefficent 1.88 Rfactor 0.1471
    Waters 103 Solvent Content 34.72

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 2qsw
    1. Building an understanding of cystic fibrosis on the foundation of ABC transporter structures
    JL Mendoza, PJ Thomas - Journal of bioenergetics and biomembranes, 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch