.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Putative Transcriptional Regulator LysR From Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2qsx Target Id APC90902.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5999,NP_797014.1, 223926 Molecular Weight 24694.95 Da.
    Residues 215 Isoelectric Point 6.26
    Sequence iqhatasliqtntdqellvvdvtpsfaslwlvpnindfhqrhpnirvkiltgdgavknihgesdlhvrc lplsthyeysqllceetllligntnlpklsdnqaishypfipqttrpqlweqfkqendlecpityhsvg fehfylaceavrmekglallpdfmaqfsilrgdiqhignlklhsgygyyvvipnfrltsrkvalfhdwl kdklthht
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.64 Rfree 0.23982
    Matthews' coefficent 1.87 Rfactor 0.20450
    Waters 257 Solvent Content 34.22

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch