.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qwv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein VCA1059. To be Published
    Site MCSG
    PDB Id 2qwv Target Id APC27114
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5377,AAF96953, BIG_123.2, 243277 Molecular Weight 22776.12 Da.
    Residues 205 Isoelectric Point 6.55
    Sequence mrntmrsfilrarsaptdsqrlldeiggkchteilahcmmnslftaqshredvvihlvlestrdysrti tveaneisdvggfheaaliallvkaldasvgmgkeqtrvvqpgltvrtisfeallgelaehhslymmdk kgdsirdikigpnpcfiltdhipmpkksgnsmkrlgvekislgpkmlfasqcvtlihneidhqeagw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.26533
    Matthews' coefficent 2.68 Rfactor 0.20846
    Waters 40 Solvent Content 54.15

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qwv
    1. 3D-Fun: predicting enzyme function from structure
    M Von Grotthuss, D Plewczynski, G Vriend - Nucleic Acids , 2008 - Oxford Univ Press
     
    2. Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
    HY Chen, YA Yuan - Journal of Molecular Cell Biology, 2010 - jmcb.oxfordjournals.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch