.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the GAF domain region of putative membrane protein from Geobacter sulfurreducens PCA. To be Published
    Site MCSG
    PDB Id 2qyb Target Id APC87689.1
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS5891,AAR34803.1, 3.30.450.40, 243231 Molecular Weight 19933.11 Da.
    Residues 175 Isoelectric Point 5.42
    Sequence lraseimnrtldlqiimddllnlllkefkldlavirlvdekgvlrvrsysgkgiagiagkdwepeiety igeaflsnrlqfvndtqymtkpltrelmqkegiksfahipisrkgeppfgilsvfsrtivglfnepfln lleslagqlaqavkivtemeakerereekerillena
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.22919
    Matthews' coefficent 2.63 Rfactor 0.20533
    Waters 17 Solvent Content 53.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qyb
    1. Crystal structure of SpoVT, the final modulator of gene expression during spore development in Bacillus subtilis
    I Asen, S Djuranovic, AN Lupas, K Zeth - Journal of molecular biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch