.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qyt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 2-dehydropantoate 2-reductase from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2qyt Target Id APC81190
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5645,AAQ67146.1, 242619 Molecular Weight 34799.09 Da.
    Residues 314 Isoelectric Point 5.05
    Sequence mnqqpikiavfglggvggyygamlalraaatdgllevswiargahleairaagglrvvtpsrdflarpt cvtdnpaevgtvdyilfctkdydmergvaeirpmigqntkilpllngadiaermrtylpdtvvwkgcvy isarksapglitleadrelfyfgsglpeqtddevrlaelltaagiraynptdidwyimkkfmmisvtat atayfdkpigsiltehepellslleevaelfrakygqvpddvvqqlldkqrkmppestssmhsdflqgg stevetltgyvvreaealrvdlpmykrmyrelvsrtan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.26479
    Matthews' coefficent 2.18 Rfactor 0.19493
    Waters 147 Solvent Content 43.59

    Ligand Information
    Ligands SO4 (SULFATE) x 5;EDO (1,2-ETHANEDIOL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2qyt
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     
    2. Fragment Finder 2.0: a computing server to identify structurally similar fragments
    R Nagarajan, S Siva Balan, R Sabarinathan - Journal of Applied , 2012 - scripts.iucr.org
     
    3. P03. 10.33
    D Kuroda, H Shirai, M Kobori, H Nakamura - Acta Cryst, 2008 - journals.iucr.org
     
    4. P03. 10.31
    LR Castillo - Acta Cryst, 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch