.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qz7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a homologue of telluride resistance protein (TerD), SCO6318 from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 2qz7 Target Id APC7352
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5123,NP_630413.1, 100226 Molecular Weight 20880.21 Da.
    Residues 190 Isoelectric Point 6.07
    Sequence msrrglereggkpvssdakglkrvdvrlkwdpspwdrpphhldiiattyaadaphgrpvyvvqfdkrsp dgtinmsrhsrtgqgfgfveemtfeldrlspsiarvivgvaihqdnghktfddvsntgvvvaegyrell tdgfervagataatvaeftrnasgawefreavrgfdsdpvlfatemgsaprp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.22546
    Matthews' coefficent 2.29 Rfactor 0.1895
    Waters 117 Solvent Content 46.32

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals NA (SODIUM) x 7

    Jmol

     
    Google Scholar output for 2qz7
    1. NMR Structure and Calcium-Binding Properties of the Tellurite Resistance Protein TerD from Klebsiella pneumoniae
    YR Pan, YC Lou, AB Seven, J Rizo, C Chen - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch