.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MMP1188, unknown function protein. To be Published
    Site MCSG
    PDB Id 2qzg Target Id APC86528.1
    Molecular Characteristics
    Source Methanococcus maripaludis s2
    Alias Ids TPS5854,CAF30744.1, BIG_119.1, 267377 Molecular Weight 10118.90 Da.
    Residues 90 Isoelectric Point 4.90
    Sequence mfsakklspadklknissmleeivedttvprniraaadnaknalhneeqelivrsataiqylddisedp nmpihtrtqiwgivseletik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.26176
    Matthews' coefficent 2.28 Rfactor 0.2085
    Waters 122 Solvent Content 46.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch