.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qzi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein of unknown function from Streptococcus thermophilus LMG 18311. To be Published
    Site MCSG
    PDB Id 2qzi Target Id APC86636
    Molecular Characteristics
    Source Streptococcus thermophilus lmg 18311
    Alias Ids TPS5862,AAV60306.1, BIG_53.1, 264199 Molecular Weight 11700.84 Da.
    Residues 100 Isoelectric Point 6.05
    Sequence mklinttwthqelvnnqldntdaflvetysagntdvvftqapkhyellisnkhravkdnelevireffl krkidkdivlmdklrtvhtdklieisfpttv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.25112
    Matthews' coefficent 3.50 Rfactor 0.21025
    Waters 163 Solvent Content 64.90

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals NA (SODIUM) x 7

    Jmol

     
    Google Scholar output for 2qzi
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch