.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r2c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of the outer membrane lipoprotein Omp28 from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2r2c Target Id APC90180.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5971,AAQ67122.1, 242619 Molecular Weight 20742.53 Da.
    Residues 183 Isoelectric Point 5.43
    Sequence rteagdayyskfanntplpalmvsrkkfgssyvydksyktwdvpiaeqmeqkakinifavaeytdtqki kvtvkgkilegntlpksmvqvylledkliapqvdgnttvenyehnhvlrgavngiwgeefvnlkdylyt yaveplsgmsfvaenysivafvydvqtfevydvvhvkinpqsdgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.20076
    Matthews' coefficent 2.32 Rfactor 0.17392
    Waters 350 Solvent Content 47.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r2c
    1. Dimerization of the SARS coronavirus 3CL protease is controlled through long-range interactions
    JA Barrila - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch