.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r2z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hemolysin domain from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 2r2z Target Id APC85144
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5764,AAO80521.1, PF03471, 226185 Molecular Weight 10303.92 Da.
    Residues 90 Isoelectric Point 4.03
    Sequence devenlytqvadneylvqgrmlidefnevfetdlhmsdvdtmagylitalgtipdegekpsfevgnikl taeemegtrllvlrvhfydee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.17082
    Matthews' coefficent 2.12 Rfactor 0.15448
    Waters 144 Solvent Content 41.88

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2r2z
    1. Protein Design Using Continuous Rotamers
    P Gainza, KE Roberts, BR Donald - PLoS computational biology, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch