.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r39

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of FixG-related protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 2r39 Target Id APC91026.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6007,NP_799431.1, 223926 Molecular Weight 12900.99 Da.
    Residues 115 Isoelectric Point 4.90
    Sequence qiaavdpagmsvirdrnqlfrvnsageventytlkvinktqqvqeynldvkglndvswygkqtiqvepg evlnlpmslgadpdklnsaittiqfiltdksneftievesrfikkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.02 Rfree 0.23815
    Matthews' coefficent 2.98 Rfactor 0.20341
    Waters 47 Solvent Content 58.77

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch