.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r4q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a domain of fruA from Bacillus subtilis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2r4q Target Id APC86784.1
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5868,CAB13313.1, BIG_517.1, 224308 Molecular Weight 11179.45 Da.
    Residues 103 Isoelectric Point 8.06
    Sequence kilavtacptgiahtfmaadalkekakelgveikvetngssgikhkltaqeiedapaiivaadkqveme rfkgkrvlqvpvtagirrpqeliekamnqdapiy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.233
    Matthews' coefficent 2.28 Rfactor 0.198
    Waters 209 Solvent Content 45.96

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch