.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r5f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative sugar-binding domain of trancsriptional regulator DeoR from Pseudomonas syringae pv. tomato. TO BE PUBLISHED
    Site MCSG
    PDB Id 2r5f Target Id APC84820
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5748,AAO55905.1, PF04198, 223283 Molecular Weight 28330.92 Da.
    Residues 261 Isoelectric Point 5.34
    Sequence rpqglhleletrlqkmygirqvivveatepddeesikqaigsaaahyletslsaqdhigisswsstira mvshmhpqpgkqsaqevvqllggvgnkgafeatlltqrlatllncpafllpsqsieqsveskqriveme evkevlhrfdsitlaivgigelepsqllrnsgnyytedmlrvlaergavgdiclryfdaqgkpvleede efvvsmglgklrsinrvlglaggvrkvqaikgallggyldvlitdvgtarglgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.252
    Matthews' coefficent 2.22 Rfactor 0.195
    Waters 108 Solvent Content 44.59

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2r5f
    1. Crystal structure of the full-length sorbitol operon regulator SorC from Klebsiella pneumoniae: structural evidence for a novel transcriptional regulation mechanism
    D de Sanctis, CE McVey, FJ Enguita - Journal of molecular , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch