.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r5r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of DUF198 from Nitrosomonas europaea ATCC 19718. To be Published
    Site MCSG
    PDB Id 2r5r Target Id APC86493
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5852,CAD85074.1, BIG_107.1, 228410 Molecular Weight 30602.09 Da.
    Residues 268 Isoelectric Point 6.00
    Sequence mnkqidlpiadvqgsldtrhiaidrvgikairhpvvvadkgggsqhtvaqfnmyvnlphnfkgthmsrf veilnshereisvesfeeilrsmvsrlesdsghiemafpyfinksapvsgvkslldyevtfigeikhgn qysftmkvivpvtslcpcskkisdygahnqrshvtisvrtnsfiwiediiriaeeqascelygllkrpd ekyvteraynnpkfvedivrdvaevlnhddridayivesenfesihnhsayalierdkrir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.05 Rfree 0.26052
    Matthews' coefficent 3.69 Rfactor 0.23905
    Waters Solvent Content 66.66

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;IMD (IMIDAZOLE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2r5r
    1. Zinc-independent folate biosynthesis: genetic, biochemical, and structural investigations reveal new metal dependence for GTP cyclohydrolase IB
    B Sankaran, SA Bonnett, K Shah, S Gabriel - Journal of , 2009 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch