.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r5s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of protein VP0806 (unknown function) from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 2r5s Target Id APC90868.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5998,NP_797185.1, 223926 Molecular Weight 19470.97 Da.
    Residues 173 Isoelectric Point 4.59
    Sequence spdeqllkqvsellqqgehaqalnviqtlsdelqsrgdvklakadclletkqfelaqellatipleyqd nsyksliaklelhqqaaespelkrleqelaanpdnfelacelavqynqvgrdeealellwnilkvnlga qdgevkktfmdilsalgqgnaiaskyrrqlysily
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.14 Rfree 0.27922
    Matthews' coefficent 2.42 Rfactor 0.22343
    Waters 60 Solvent Content 49.24

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 4;EDO (1,2-ETHANEDIOL) x 3;ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2r5s
    1. Escherichia coli thioredoxin-like protein YbbN contains an atypical tetratricopeptide repeat motif and is a negative regulator of GroEL
    J Lin, MA Wilson - Journal of Biological Chemistry, 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch