.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r6h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Domain Comprising the Regions Binding NAD and FAD from the NADH:Ubiquinone Oxidoreductase, Na Translocating, F Subunit from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2r6h Target Id APC90368.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5975,AAQ67126.1, 242619 Molecular Weight 32991.73 Da.
    Residues 287 Isoelectric Point 5.28
    Sequence vfgvkewecevlsnknvstfikefvvklpegetmnfksgsyaqikipkyniryadydiqdrfrgdwdkm dawsltckneeetvraysmanypaegniitlnvriatppfdraankwkagikpgisssyifslkpgdkv mmsgpygdfhiqdtdaemlyigggagmaplraqilhlfrtlktgrkvsywygarskneifyeedfreie refpnfkfhialsdpqpednwtgyvgfihqviydnylkdhdapedieyymcgpgpmanavkgmlenlgv prnmlffddfg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.95 Rfree 0.271
    Matthews' coefficent 3.48 Rfactor 0.215
    Waters 254 Solvent Content 64.69

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 4;SO4 (SULFATE) x 11
    Metals

    Jmol

     
    Google Scholar output for 2r6h
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Sodium-translocating NADH: quinone oxidoreductase as a redox-driven ion pump
    MI Verkhovsky, AV Bogachev - Biochimica et Biophysica Acta (BBA)- , 2010 - Elsevier
     
    3. Crystallization of the Na+-translocating NADH: quinone oxidoreductase from Vibrio cholerae
    MS Casutt, S Wendelspiess, J Steuber - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Cys377 residue in NqrF subunit confers Ag+ sensitivity of Na+-translocating NADH: quinone oxidoreductase from Vibrio harveyi
    MS Fadeeva, YV Bertsova, L Euro, AV Bogachev - Biochemistry (Moscow), 2011 - Springer
     
    5. Low-resolution structure determination of Na+-translocating NADH: ubiquinone oxidoreductase from Vibrio cholerae by ab initio phasing and electron microscopy
    VY Lunin, NL Lunina, MS Casutt, K Knoops - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch