The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Atu1473 protein, a putative chaperone from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2r6i Target Id APC6123
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5014,NP_532163.1, 176299 Molecular Weight 29231.66 Da.
    Residues 264 Isoelectric Point 4.71
    Sequence mrdllndlseglshpdpilraqiqmqkplpkrfykdvtvadveeggftilldgkplrtpakkplvapsr aladllrdewdaqkevvnpvvmpvsrhvntaidgiasdtqavfedilrfsssdllcyragdpealvarq tdywdpvldwatnvlgarfilvegvmhrdqpreaiaafavtlkkydtpialaalhtmtsltgsailala laegeltleeawalahldedwtaeqwgedeealerravrlidmraalnvleslksas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.59 Rfree 0.28943
    Matthews' coefficent 2.60 Rfactor 0.23980
    Waters 30 Solvent Content 52.71

    Ligand Information


    Google Scholar output for 2r6i
    1. Chaperones of F1-ATPase
    A Ludlam, J Brunzelle, T Pribyl, X Xu, DL Gatti - Journal of Biological , 2009 - ASBMB

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch