.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r78

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of the sensory box sensor histidine kinase/response regulator from Geobacter sulfurreducens. To be Published
    Site MCSG
    PDB Id 2r78 Target Id APC87665.2
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS5888,AAR34661.1, 3.30.450.20, 243231 Molecular Weight 11482.29 Da.
    Residues 105 Isoelectric Point 4.71
    Sequence yralfehaidgifimdaeghyldvnpaicsaigytrdeflaldwgvlsrgvdsgwaaaslarivggepl reertvwtrngdqltvelsahllpdgkilgiardvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.22098
    Matthews' coefficent 2.21 Rfactor 0.17906
    Waters 483 Solvent Content 44.23

    Ligand Information
    Ligands ACT (ACETATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 2r78
    1. Aminoglycoside-2 phosphotransferase-IIIa (APH (2)-IIIa) prefers GTP over ATP: Structural templates for nucleotide recognition in the bacterial aminoglycoside-2
    CA Smith, M Toth, H Frase, LJ Byrnes - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch