.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r8d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa. TO BE PUBLISHED
    Site MCSG
    PDB Id 2r8d Target Id APC86234.2
    Related PDB Ids 2oai 
    Molecular Characteristics
    Source Xylella fastidiosa temecula1
    Alias Ids TPS5842,AAO28409.1, PF03471, 183190 Molecular Weight 10352.00 Da.
    Residues 91 Isoelectric Point 4.19
    Sequence entdedalmvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgriphvgeyfdwag wrieivdldgaridklllqrln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.220
    Matthews' coefficent 2.65 Rfactor 0.171
    Waters 68 Solvent Content 53.51

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1;MN (MANGANESE) x 1

    Jmol

     
    Google Scholar output for 2r8d
    1. Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26
    E Martinez-Hackert, WA Hendrickson - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2oai.png
    No description
    19.21 kB22:14, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch