.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r9i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of putative phage capsid protein domain from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2r9i Target Id APC90619.1
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5985,CAE48709.1, 1717 Molecular Weight 15084.83 Da.
    Residues 138 Isoelectric Point 5.21
    Sequence mnlkdllahrenlmdsakrarsaitddmdpadaaqavenvksiiseiestdeaiaarrgvsdvtqklkg ltitergtendsaasrslgehfvkaagdrlknqaagahieysvpeyqvkedahsspkdlvegwgtfyqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.24184
    Matthews' coefficent 2.93 Rfactor 0.21858
    Waters 9 Solvent Content 57.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r9i
    1. Les polydres viraux: armures cristallines des virus d'insectes
    F Coulibaly - Virologie, 2012 - jle.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch