The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative transcriptional regulator from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 2ra5 Target Id APC7351
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5122,NP_630356.1, 100226 Molecular Weight 26594.75 Da.
    Residues 245 Isoelectric Point 6.09
    Sequence msldlsvdrsspvplyfqlsqqleaaiehgaltpgsllgneielaarlglsrptvrqaiqslvdkgllv rrrgvgtqvvhskvrrplelsslyddleaagqrpatkvlvntvvpataeiaaalgvaedsevhrierlr lthgepmaylcnylppglvdldtgqleatglyrlmraagitlhsarqsigaraatsgeaerlgedagap lltmerttfddtgravefgthtyrpsrysfefqllvrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.292
    Matthews' coefficent 1.51 Rfactor 0.218
    Waters 52 Solvent Content 18.73

    Ligand Information
    Ligands IPA (ISOPROPYL) x 1;SRT (S,R) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch