.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rdp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a MarR family protein from Bacillus stearothermophilus. TO BE PUBLISHED
    Site MCSG
    PDB Id 2rdp Target Id APC35941
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5529,RBSTP1228, 1422 Molecular Weight 17268.01 Da.
    Residues 147 Isoelectric Point 5.60
    Sequence mpsamnertvaelekllryiaanlkqrgreiltnypitppqfvalqwlleegdltvgelsnkmylacst ttdlvdrmernglvarvrdehdrrvvrirllekgeriieeviekrqrdlanvlesfsdeeivvferclr klhqemtke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.253
    Matthews' coefficent 3.44 Rfactor 0.211
    Waters 78 Solvent Content 64.28

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;BME (BETA-MERCAPTOETHANOL) x 2
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch